PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG651000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 429aa    MW: 46033.2 Da    PI: 4.7527
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG651000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.8e-19115161148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          +g+WT+eEd +l+d v+q+G + W+ Ia+ ++ gR +kqc++rw ++l
  Pavir.5KG651000.1.p 115 KGSWTEEEDSILKDMVTQFGERKWSVIAQSLP-GRIGKQCRERWINHL 161
                          799*****************************.************996 PP

2Myb_DNA-binding46.21.1e-14171210445
                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          WT+e+d+ l+ a+k +G++ W++Iar ++ gR+++ +k++w+
  Pavir.5KG651000.1.p 171 WTEEDDKMLIGAHKYFGNR-WSSIARFLP-GRSENAVKNHWN 210
                          *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.619110165IPR017930Myb domain
SuperFamilySSF466891.04E-29114209IPR009057Homeodomain-like
SMARTSM007172.2E-16114163IPR001005SANT/Myb domain
PfamPF002495.3E-16115161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-23115163IPR009057Homeodomain-like
CDDcd001673.07E-15117161No hitNo description
Gene3DG3DSA:1.10.10.607.9E-18164214IPR009057Homeodomain-like
SMARTSM007171.3E-11167215IPR001005SANT/Myb domain
PROSITE profilePS5129414.7167217IPR017930Myb domain
PfamPF002491.2E-12171210IPR001005SANT/Myb domain
CDDcd001674.39E-12171213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MAFNNSILIN RVLESQLIGD EATISNLASS SHDDPQFDHN LAAPSSMQAG GTQFMDVPLD  60
MSSLVASIDM TPTGFEVPEG AIVASSYNTL GGVPIDVEEV PQPQTGSNDK PAPFKGSWTE  120
EEDSILKDMV TQFGERKWSV IAQSLPGRIG KQCRERWINH LRPDIKQNDI WTEEDDKMLI  180
GAHKYFGNRW SSIARFLPGR SENAVKNHWN ATKRSLKAKR RLKKKKSEQQ VPPGQLSILE  240
EYIRSLPPAS DSAAPPPAAS PPLQGPAYSG PIVSEAVHPP APEMEMNFNA ASPAGPPLSL  300
HLPGMINHNM PQLPDLNISC DPQEASYMSY AMNAPSPAPQ LQLVTPDPQQ ATFSWFPFVE  360
YLTALNTGLA AGPSYYAGGS SSNASANGYY SGAGAGYYYS EAGPSNAGGS DGEPAGDDTP  420
ASWRRGSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-401152144102C-Myb DNA-Binding Domain
1msf_C2e-401152144102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.10.0PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS580.0K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-41myb domain protein 98